PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA102G00329
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 849aa    MW: 97220.9 Da    PI: 10.2132
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA102G00329genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.92.5e-1521971295
                 HTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
           B3 12 ksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                 +++ l++p +f+++h +g k++++t++l++  s  +W+vkl  ++ +    ltkGWkeF+  ++L+ gD+++F+ +   + e++v+
  AA102G00329 21 SNDHLTIPTEFFSNHiEG-KTRKRTVKLRSdASDTVWKVKL--TGLK----LTKGWKEFATGHDLRIGDIIIFRQE--GDLEFNVT 97
                 5677***********654.56778*****97888*******..6665....***********************54..45555665 PP

2B358.31.4e-18178269799
                  .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  + ++lk + l+lpk+  + ++++ke++ ++tl +++grsW++ l+yr + g y++++ W  F+++ng k+gD+++Fk++ +++ ++v++++++
  AA102G00329 178 TTSNLKFDTLYLPKRVSRLISLSKEKD-EITLVNLEGRSWKLVLKYRASTGNYYMRGAWTCFCHENGRKAGDSFTFKVVVSEKSSPVIMMCST 269
                  567778899********9999998876.*************************************************9977888899999986 PP

3B338.12.7e-12312409199
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--.TT-EEEEEE-SSSEE..EEEE CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLk.egDfvvFkldgrsefelvvkv 96 
                  f+++ ++++++k++ l+lp +f+e +g+   +  +++l+d++g++   +l     k g+  l+kGW+ F++an++   g  +v++l++ +++ +v+k+
  AA102G00329 312 FVTINLTPYNFKTSKLILPVQFTEINGLT--QLSKIILMDKNGEKRLTNLVQdGPKYGKRGLGKGWRAFCEANDVMkIGVPFVLELIW-EDKVPVLKF 406
                  788899*****************888887..4449********999999977633334456*************9769**********.777799999 PP

                  E-S CS
           B3  97 frk 99 
                  ++k
  AA102G00329 407 CSK 409
                  987 PP

4B348.41.7e-154725451797
                  E--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3  17 vlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  ++p  f+++h +g k+++kt++l++  sg +W+vkl  ++ +    lt+GWkeF+ a++L+ gD+v F+   + + e++v+ f
  AA102G00329 472 TIPAAFFSNHiEG-KTRKKTVKLRSnASGTVWKVKL--TGLK----LTEGWKEFATAHHLRIGDVVFFRQ--EGDLEFHVTPF 545
                  79*****999654.56789*****98999*******..6665....***********************4..45666677655 PP

5B357.13.2e-18621710999
                  HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  ++l  + l lpk+ ++ ++++ke + ++tl++++grsW++ l+yr + g y++++ W  F+++ng k+gD+++Fk++ +++ ++v++++++
  AA102G00329 621 SNLIFDTLHLPKRVTRLISLSKEIH-EITLMNSEGRSWKLVLKYRASTGNYYMRGAWTCFCHENGRKAGDSFTFKVVVSEKSSPVIMMCSA 710
                  333346799******9999999987.*************************************************9977888899999986 PP

6B337.54.2e-12748845199
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--.TT-EEEEEE-SSSEE..EEEE CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLk.egDfvvFkldgrsefelvvkv 96 
                  f++++++s++lks+ l+lp +f+e +g+      +++l++++g++   +l     + gr  l+kGW+ F++an++   g  +v++l++ +++ +v+k+
  AA102G00329 748 FVTITLTSYNLKSSKLILPVQFTEINGLTD-F-SKIILMNKNGEKRLTNLVQdGPNYGRRGLGKGWRAFCEANDVMkIGVPFVLELIW-EDKVPVLKF 842
                  788999*****************8888774.4.48********999999977745555567*************9769**********.777799999 PP

                  E-S CS
           B3  97 frk 99 
                  ++k
  AA102G00329 843 CSK 845
                  986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.9E-207104IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-207108IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.7610102IPR003340B3 DNA binding domain
CDDcd100174.14E-141199No hitNo description
SMARTSM010191.4E-1813102IPR003340B3 DNA binding domain
PfamPF023629.0E-112195IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-16167267IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-16170267IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.48172270IPR003340B3 DNA binding domain
SMARTSM010192.2E-19173270IPR003340B3 DNA binding domain
PfamPF023623.0E-17176269IPR003340B3 DNA binding domain
CDDcd100177.71E-13179253No hitNo description
Gene3DG3DSA:2.40.330.107.6E-15309409IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-12309408IPR015300DNA-binding pseudobarrel domain
CDDcd100179.96E-9311408No hitNo description
PROSITE profilePS508639.037312409IPR003340B3 DNA binding domain
SMARTSM010193.2E-19312410IPR003340B3 DNA binding domain
PfamPF023629.6E-12312409IPR003340B3 DNA binding domain
SMARTSM010191.6E-12468548IPR003340B3 DNA binding domain
SuperFamilySSF1019361.71E-16469554IPR015300DNA-binding pseudobarrel domain
CDDcd100175.45E-12472545No hitNo description
PfamPF023623.4E-11472542IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-18472558IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.153473548IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-16609707IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.87E-16610706IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.254613711IPR003340B3 DNA binding domain
CDDcd100177.93E-13613694No hitNo description
SMARTSM010192.9E-19614711IPR003340B3 DNA binding domain
PfamPF023625.4E-17618710IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.6E-14746845IPR015300DNA-binding pseudobarrel domain
CDDcd100175.82E-10747844No hitNo description
SuperFamilySSF1019363.53E-12747845IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.2E-20748846IPR003340B3 DNA binding domain
PfamPF023622.3E-11748845IPR003340B3 DNA binding domain
PROSITE profilePS508639.474748845IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 849 aa     Download sequence    Send to blast
MADLLHQSPN PHFFQPILPD SNDHLTIPTE FFSNHIEGKT RKRTVKLRSD ASDTVWKVKL  60
TGLKLTKGWK EFATGHDLRI GDIIIFRQEG DLEFNVTPFG PSMCEIQYTP FRNRVNDDDD  120
DEDEDTIRKV SSVLESKNTE KKCFPDSGKV LRKRNSKRKR EQEESSLSNE NYFVAYATTS  180
NLKFDTLYLP KRVSRLISLS KEKDEITLVN LEGRSWKLVL KYRASTGNYY MRGAWTCFCH  240
ENGRKAGDSF TFKVVVSEKS SPVIMMCSTE ECWGHMSKYK MRKKLKKTIK RRRQWVASAS  300
SSSSTSLRGN RFVTINLTPY NFKTSKLILP VQFTEINGLT QLSKIILMDK NGEKRLTNLV  360
QDGPKYGKRG LGKGWRAFCE ANDVMKIGVP FVLELIWEDK VPVLKFCSKV WAFGYPFSSG  420
SLLSGIRFFG SMSVGSNGYL EEFGNVSRKR NLKRKIGQEC SLSDENYFVA YTIPAAFFSN  480
HIEGKTRKKT VKLRSNASGT VWKVKLTGLK LTEGWKEFAT AHHLRIGDVV FFRQEGDLEF  540
HVTPFGPSFC EIQYTLSRNR EDEDQDNVPK VNSVLESKNT EKNCFLDSRN VSRKKKNLKR  600
KMKQECSLSD ENYFVAYVTT SNLIFDTLHL PKRVTRLISL SKEIHEITLM NSEGRSWKLV  660
LKYRASTGNY YMRGAWTCFC HENGRKAGDS FTFKVVVSEK SSPVIMMCSA EECWGHMSKY  720
KMRKKLKKNT KTASFSASSS TSLRGSRFVT ITLTSYNLKS SKLILPVQFT EINGLTDFSK  780
IILMNKNGEK RLTNLVQDGP NYGRRGLGKG WRAFCEANDV MKIGVPFVLE LIWEDKVPVL  840
KFCSKLIPV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1594601KKNLKRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623119.11e-135PREDICTED: B3 domain-containing protein REM7 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.12e-74B3 family protein